If you have been reading about fatty acid oxidation and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2025-11-20. Where a claim depends on a specific study, the study is described rather than over-claimed.
Human trials of GW501516 were small and short in duration. They examined lipid levels, glucose handling, and other metabolic markers, but the programs were halted after the animal cancer findings. No approved therapeutic product exists, and published human data are insufficient for establishing long-term safety. Reports of use for athletic performance come mainly from non-clinical settings and cannot be verified through controlled trials. Independent testing of products sold as cardarine has found inconsistent purity and labeling.
Laboratory studies indicate that GW501516 activates PPARδ, a nuclear receptor involved in fatty acid oxidation and energy metabolism. In rodent experiments, treated animals often showed increased endurance and reduced fat mass. These effects were observed under controlled conditions and do not establish safe or effective use in humans. The exact dose-response relationship in humans remains poorly characterized. Species differences in metabolism can affect how results translate across animals and people.
Because cardarine is not an approved medicine, no pharmacopeial monograph defines its identity, purity, or storage requirements. Laboratories typically rely on in-house methods and reference standards when testing materials labeled as GW501516. Certificates of analysis may report purity and identity for a specific batch, but their scope varies and they do not guarantee safety or legal status. Independent verification can include high-performance liquid chromatography, mass spectrometry, nuclear magnetic resonance, and elemental analysis. The distinction between research chemical labeling and human use is significant because quality standards and oversight differ.
Cardarine can be detected in biological samples and product materials using liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS). The method separates compounds by chromatography and identifies them by mass-to-charge transitions, allowing low-level detection in urine or blood. Sample preparation often involves enzymatic hydrolysis, solid-phase extraction, or protein precipitation. Certified reference materials and isotope-labeled internal standards improve quantification. Detection windows depend on metabolism, matrix, and assay sensitivity, so no single universal window applies.
| Property | Value | Notes |
|---|---|---|
| Primary target | PPARδ (NR1C2) | Nuclear receptor involved in lipid metabolism |
| Preclinical effect | Increased fatty acid oxidation | Observed in rodent studies |
| Key safety signal | Tumors in rodents after long-term exposure | Contributed to halted clinical development |
| Human trial status | No approved product; development stopped | Limited short-term metabolic data |
| Sport regulatory status | Prohibited at all times | WADA hormone and metabolic modulators class |
Clinical development stopped after rodent studies showed tumors at multiple sites. Whether those findings predict human cancer risk remains an open question, but they led sponsors to discontinue programs. Human safety data are limited to small, short-term studies that were not designed to assess cancer risk. Reported effects in those studies included changes in blood lipids, but the evidence is insufficient for medical use. Long-term consequences of nonmedical use are not well characterized. Questions about dose, duration, and individual susceptibility remain unresolved.
Cardarine is a common name for GW501516, an investigational compound developed in the 1990s for metabolic conditions. It acts as an agonist at peroxisome proliferator-activated receptor delta, a nuclear receptor involved in lipid and energy metabolism. The compound is frequently mislabeled as a selective androgen receptor modulator, or SARM, but its molecular target is different. GW501516 reached early clinical testing before development was discontinued. It has no approved therapeutic use in any country. The name cardarine is not a formal international nonproprietary name.
Regulatory treatment varies, but cardarine is not approved as a medicine. Sports authorities list GW501516 as a prohibited substance, and it is banned at all times under the World Anti-Doping Agency code. Many countries restrict sales for human consumption, while online vendors market it as a research chemical. Such products may lack purity data, and their actual contents can differ from the label. Purchasing or possessing cardarine may carry legal consequences depending on jurisdiction. The compound is not a dietary supplement ingredient in regulated markets.
Quality assessment for cardarine samples usually combines identity, purity, and impurity testing. Nuclear magnetic resonance spectroscopy and mass spectrometry can confirm molecular structure, while high-performance liquid chromatography estimates purity. Certificates of analysis from testing laboratories may list these results, but they do not establish safety or legality. In the absence of approved manufacturing, products sold online may contain the wrong compound, variable amounts, or unlisted contaminants. Independent verification is therefore central to analytical work and to interpreting any reported biological activity.
Laboratory detection of GW501516 commonly uses liquid chromatography coupled with tandem mass spectrometry. The method can identify the parent compound or its metabolites in urine and blood after sample cleanup. Protein precipitation, solid-phase extraction, or enzymatic hydrolysis may precede analysis, depending on the matrix. Reference standards are required for accurate quantification and confirmation. Because the compound is not approved, testing often occurs in anti-doping, forensic, or research settings rather than routine clinical care. Results are reported with limits of detection and quantification.
Stability of GW501516 depends on form, temperature, light exposure, and moisture. Solid reference material is typically stored frozen or refrigerated in a desiccator and protected from light. Solutions in organic solvents such as dimethyl sulfoxide are often kept frozen in aliquots to reduce freeze-thaw cycling. Aqueous solubility is low, so aqueous stock solutions can be difficult to prepare without cosolvents. Degradation may appear as changes in chromatographic purity or mass spectral signal. Stability studies are needed to establish shelf life for any specific preparation.
Analytical laboratories typically identify cardarine and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is a common matrix in anti-doping testing, while blood and tissue may be used in research settings. Detection windows depend on the assay, the sample matrix, and the compound's metabolism. Because cardarine is extensively metabolized, laboratories often target specific metabolites to improve sensitivity and confirmation. Reference standards are required for reliable quantification. Method validation includes checks for selectivity, linearity, and carryover.
A persistent misconception is that cardarine is a fat-burning drug or a safe alternative to anabolic steroids. No approved therapeutic product exists, and human safety data are limited. The tumor findings in rodents remain a central concern in scientific reviews. Products sold online may contain inaccurate labels, impurities, or different compounds entirely, which complicates any assessment of effects. Independent testing of such products has reported frequent mislabeling. For these reasons, discussions in the literature emphasize risks and unknowns rather than benefits.
Cardarine is not approved for human therapeutic use in any major jurisdiction. It appears on the World Anti-Doping Agency Prohibited List as a PPARδ agonist within the hormone and metabolic modulators category. Sports organizations test for it because it has been detected in athlete samples and seized products. Regulatory actions against marketed research chemical versions have occurred in several countries, though enforcement varies. Availability through unregulated channels complicates oversight.
The East Asian and Arab Belizeans are an overwhelmingly urban population, with five-sixths living in cities, the highest proportion out of all tabulated ethnic groups. This is a slightly higher proportion than the Garifuna people and Creoles, but contrasting sharply with East Indians, of whom roughly half live in rural areas. East Asian and Arab Belizeans have a significant presence in the retail industry and fast food restaurant chains in Belize. Belizean Arabs mostly reside in Belize City and the towns in the islands and cayes. Belizean Arabs, although a minority, have contributed significantly to politics and education throughout the history of Belize. Some influential Arab families are the Musas, Espat, Shoman, and Chebat among others. Their influence on the People's United Party has made Belize an advocate for Palestine's right to self-determination.
== Cell-cell communication == Migrating isolated cell responds to cues in its environment and changes its behavior accordingly. As cell-cell communication does not play a major role in this case, similar trajectories are observed in different isolated cells. However, when the cell migrates as part of the collective, it not only responds to its environment but also interacts with other cells through soluble substrates and physical contact. These cell-cell communication mechanisms are the main reasons for the difference between efficient migration of the collective and random walk movements of the isolated cell. Cell-cell communication mechanisms are widely studied experimentally (in vivo and in vitro), and computationally (in silico).
==== Anticipatory action ==== Anticipatory action is a growing area of disaster management that relies on data analysis to predict where crises might strike and act ahead of time to protect the assets and agency of farmers, fishers and herders to prepare them for widely different circumstances and contexts. An anticipatory action system involves crisis timelines, early warning systems, anticipatory actions, flexible financing and evidence. Risk-informed and shock-responsive social protection systems to provide support not only to routine beneficiaries, but also at-risk and crisis-prone populations. They can expand the provision of benefits according to the emerging needs of potential beneficiaries and enable them to invest and engage in productive activities. There is a growing body of evidence pointing towards the positive impact of anticipatory action, yet it is often fragmented, incomplete in scope, and in need of methodological improvements.
== See also == Varying oxidation of sulfur Dimethyl sulfide (DMS), the corresponding sulfide, also produced by marine phytoplankton and emitted to the oceanic atmosphere where it is oxidized to DMSO, SO2 and sulfate Dimethyl sulfone, commonly known as methylsulfonylmethane (MSM), a related chemical often marketed as a dietary supplement Related compounds with methyl on oxygen Dimethyl sulfite, the corresponding sulfite Dimethyl sulfate (also DMS), the corresponding sulfate: a mutagenic alkylating compound Methyl methanesulfonate, another methylating agent Death of Gloria Ramirez, where DMSO taken by a terminally ill patient caused medical staff to fall ill
===== MeSH D08.811.913.225 – alkyl and aryl transferases (EC 2.5) ===== MeSH D08.811.913.225.224 – cysteine synthase MeSH D08.811.913.225.300 – dihydropteroate synthase MeSH D08.811.913.225.400 – dimethylallyltranstransferase MeSH D08.811.913.225.431 – farnesyl-diphosphate farnesyltransferase MeSH D08.811.913.225.437 – farnesyltranstransferase MeSH D08.811.913.225.443 – geranylgeranyl-diphosphate geranylgeranyltransferase MeSH D08.811.913.225.450 – geranyltranstransferase MeSH D08.811.913.225.500 – glutathione transferase MeSH D08.811.913.225.500.500 – glutathione S-transferase pi MeSH D08.811.913.225.575 – hydroxymethylbilane synthase MeSH D08.811.913.225.650 – methionine adenosyltransferase MeSH D08.811.913.225.735 – 3-phosphoshikimate 1-carboxyvinyltransferase MeSH D08.811.913.225.750 – riboflavin synthase MeSH D08.811.913.225.825 – spermidine synthase MeSH D08.811.913.225.912 – spermine synthase
Sources: en.wikipedia.org
The analyte molecules in a sample can be partially ordered with respect to the external magnetic field of the spectrometer by manipulating the sample conditions. Common techniques include addition of bacteriophages or bicelles to the sample, or preparation of the sample in a stretched polyacrylamide gel. This creates a local environment that favours certain orientations of nonspherical molecules. Normally in solution NMR the dipolar couplings between nuclei are averaged out because of the fast tumbling of the molecule. The slight overpopulation of one orientation means that a residual dipolar coupling remains to be observed. The dipolar coupling is commonly used in solid state NMR and provides information about the relative orientation of the bond vectors relative to a single global reference frame. Typically the orientation of the N-H vector is probed in an HSQC-like experiment. Initially, residual dipolar couplings were used for refinement of previously determined structures, but attempts at de novo structure determination have also been made.
An asymptomatic skin disorder of the vulval vestibule is vestibular papillomatosis, which is characterised by fine, pink projections from either the epithelium of the vulva or from the labia minora. Dermatoscopy can distinguish this condition from genital warts. A subtype of psoriasis, an autoimmune disease, is inverse psoriasis in which red patches can appear in the skin folds of the labia.
== History == The original Green Mountain Boys were a militia organized in what is now southwestern Vermont in the decade prior to the American Revolutionary War. They consisted of settlers and land speculators who held New Hampshire titles to lands between the Connecticut River and Lake Champlain; the area was then known as the New Hampshire Grants, but is now modern Vermont. New York was given legal control of the area by a decision of the British crown and refused to respect the New Hampshire titles and town charters. Although a few towns with New York land titles, notably Brattleboro on the Connecticut River, supported the change, the vast majority of the settlers in the sparsely populated frontier region rejected the authority of New York. With several hundred members, the Green Mountain Boys effectively controlled the area where New Hampshire grants had been issued. They were led by Ethan Allen, his brother Ira Allen, and their cousins Seth Warner and Remember Baker. They were based at the Catamount Tavern in Bennington. By the 1770s, the Green Mountain Boys had become an armed military force and de facto government, which was also a militia, that prevented New York from exercising its authority in the northeast portion of the Province of New York. New York authorities had standing warrants for the arrest of the leaders of the rebellious Vermonters but were unable to exercise them.
=== United States === As of July 2012, only six states lack legislation to regulate the professional practice of TCM: Alabama, Kansas, North Dakota, South Dakota, Oklahoma, and Wyoming. In 1976, California established an Acupuncture Board and became the first state licensing professional acupuncturists.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Sources: en.wikipedia.org
Rodent studies reported increased endurance and fat oxidation after GW501516 exposure. Long-term studies also found higher rates of some tumors, which led to halted development.
Small short-term human trials examined metabolic markers such as lipids and glucose. The trials did not continue after rodent cancer findings, so long-term human safety is unknown.
Controlled human trials have not established a performance benefit. Anecdotal reports exist, but they are not reliable evidence.
Anti-doping laboratories typically use LC-MS/MS to detect GW501516 and its metabolites in urine. The method is sensitive and can identify the compound at low concentrations. Detection depends on sample timing, metabolism, and the specific assay.